DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and proca

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_956650.1 Gene:proca / 393327 ZFINID:ZDB-GENE-060824-5 Length:434 Species:Danio rerio


Alignment Length:270 Identity:95/270 - (35%)
Similarity:145/270 - (53%) Gaps:33/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 RECA---ECSCGNIN-------------TRHRIVGGQETEVHEYPWM-IMLMWFGNFYCGASLVN 114
            |:|.   :.|||.|.             .:..::||...:..|.||. ::|...|.|:||..|::
Zfish   163 RKCTPKNDASCGQIRIPKSAYANKPKPVLQPWVMGGNVGKRGESPWQALILNHLGRFHCGGVLID 227

  Fly   115 DQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNE 179
            :.:.||||||:.  .....:|||.::.|.......|...|.:.:.||:|:....|:||||:|.:.
Zfish   228 ENWVLTAAHCLE--TSSKFSVRLGDYQRFKFEGSEVTLPVKQHISHPQYNPITVDNDIALLRLDG 290

  Fly   180 PVRLGIDMHPVCMPTPSENYA-------GQTAVVTGWGALSEGG-PISDTLQEVEVPILSQEECR 236
            ||:....:.|.|:  ||...|       |...::||||..::.. ..:.||..||:||:..:|| 
Zfish   291 PVKFSTYILPACL--PSLELAKRMLHRNGTVTIITGWGKNNQSATSYNSTLHYVELPIVDNKEC- 352

  Fly   237 NSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVY 301
             |.:..:.::|||:|||.:.| .||:|:|||||||..| ..|.:.|.|:|||||||.:.:..|:|
Zfish   353 -SRHMMNNLSDNMLCAGVLGQ-VKDACEGDSGGPMMTL-FHDTWFLVGLVSWGEGCGQRDKLGIY 414

  Fly   302 TRVGSFNDWI 311
            |:|.|:.|||
Zfish   415 TKVASYLDWI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 87/237 (37%)
Tryp_SPc 83..314 CDD:238113 89/238 (37%)
procaNP_956650.1 GLA 23..84 CDD:214503
EGF_CA 85..119 CDD:238011
FXa_inhibition 128..165 CDD:291342 1/1 (100%)
Tryp_SPc 195..427 CDD:238113 89/238 (37%)
Tryp_SPc 197..424 CDD:214473 87/234 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.