DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and ovch1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_956439.2 Gene:ovch1 / 393114 ZFINID:ZDB-GENE-040426-834 Length:556 Species:Danio rerio


Alignment Length:386 Identity:116/386 - (30%)
Similarity:184/386 - (47%) Gaps:86/386 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CNFHLLLILATALGDLACATPSLRSASDPEKILNN----LAQLRQSSFLDWIQSILGPEVPAEWS 62
            |.|.|:|.|.....|      |..|:.:.:.||:.    ||.:|  ||:        ||...|.|
Zfish     7 CLFILILTLKWTKAD------SDASSFETDCILDKGCDVLAGIR--SFV--------PEDEVEES 55

  Fly    63 SPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNG 127
                               ||:||:|...|.:||.:.|.:.....||.::::..:.:||.||...
Zfish    56 -------------------RIIGGKEAWAHSWPWQVSLQYNDVPTCGGAILDQLWVITAGHCFKR 101

  Fly   128 F-----YHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEP------V 181
            :     ::.::.:..|::..:.|...|   :|.::..|..|:.:..::||||::...|      |
Zfish   102 YKKPSMWNAVVGLHNLDNANESSRESI---QVQKIFSHKNYNQKTNENDIALLKLQSPLVFSKFV 163

  Fly   182 R-LGI---DMHPVCMPTPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGE 242
            | :|:   |:.|:.           |..|||||:::|.||.:..||||.|.:...::|  :.:..
Zfish   164 RPIGVFNNDLPPLV-----------TCTVTGWGSVTENGPQASRLQEVNVTVYEPQKC--NRFYR 215

  Fly   243 SKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSF 307
            .|:..:||||| ..:||.|:||||||||:... .|:.|:|||:||||.||.:...|||||.:..:
Zfish   216 GKVLKSMICAG-ANEGGMDACQGDSGGPLSCF-DGERYKLAGVVSWGVGCGRAQKPGVYTTLYHY 278

  Fly   308 NDWIAENTR-----DACSCAQPEAAGEPASPMETTEQGD---QENTTANGAAEADPEVEEA 360
            ..|:..:.|     :|.|.||   .|:  :.||.....|   |..:|.|||.:.: .|.||
Zfish   279 RQWMVSSMRGELAVEADSDAQ---CGQ--AKMEPCRLPDGLAQVVSTENGAFKVE-NVSEA 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 79/243 (33%)
Tryp_SPc 83..314 CDD:238113 79/245 (32%)
ovch1NP_956439.2 Tryp_SPc 56..281 CDD:214473 79/242 (33%)
Tryp_SPc 57..281 CDD:238113 78/241 (32%)
Tryp_SPc 331..551 CDD:238113 2/3 (67%)
Tryp_SPc 331..549 CDD:214473 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.