DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG18180

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:266 Identity:76/266 - (28%)
Similarity:113/266 - (42%) Gaps:72/266 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMW------FGNFYCGASLVNDQYALTAAHCV--------------- 125
            |||.|......:.|:::.|..      .|....|..:.|| :.||||||:               
  Fly    35 RIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIAND-WILTAAHCLTGDYVEIHYGSNWGW 98

  Fly   126 NGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIR-----FNEPVRLGI 185
            ||.|.:.:        |:|:.:.           ||.:.::. ..||.|||     ||..:..  
  Fly    99 NGAYRQTV--------RRDNFIS-----------HPDWPSQG-GRDIGLIRTPHVDFNGLINK-- 141

  Fly   186 DMHPVCMPTPSEN-----YAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKI 245
                  :|.||.|     |.....|..|||.: :.|.::|.||.|:|.|:|..||..: ||....
  Fly   142 ------IPLPSMNEQNDRYQDTWCVACGWGGM-DNGNLADWLQCVDVQIISNSECEQA-YGSVAS 198

  Fly   246 TDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGE-GCAKPNAPGVYTRVGSFND 309
            ||  :|..:.:  ||..|.||||||   |.:.|..:|.|::::.. .|  .:.|..||||..:.:
  Fly   199 TD--MCTRHAD--GKSVCGGDSGGP---LVTHDNARLVGVITFASVSC--HDGPSGYTRVSDYLE 254

  Fly   310 WIAENT 315
            ||.:.|
  Fly   255 WIRDQT 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 73/260 (28%)
Tryp_SPc 83..314 CDD:238113 74/262 (28%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 73/260 (28%)
Tryp_SPc 36..259 CDD:238113 74/262 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.