DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG3088

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:254 Identity:66/254 - (25%)
Similarity:110/254 - (43%) Gaps:51/254 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 HRIVGGQETEVHEYPWMIMLMWFG--NFYCGASLVNDQYALTAAHCVNG-----FYH---RL--- 132
            |.|..|......:.|:::. |.||  |.:|..:::.|.:.||:|.|:.|     .|.   ||   
  Fly    27 HIITNGSPAYEGQAPYVVG-MAFGQSNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQA 90

  Fly   133 ---ITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPT 194
               :||...|:...:.|:.:|  ||.||    .:|.|                    ::.|.:|:
  Fly    91 QFTVTVGTSEYVTGNQHLALV--RVPRV----GFSNR--------------------VNRVALPS 129

  Fly   195 ---PSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVE 256
               .|:.|....|.|.|||..:....::|.||.|::.|:|..|| .:.||.:.::|.::|..  .
  Fly   130 LRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNEC-IAFYGSTTVSDQILCTR--T 191

  Fly   257 QGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENT 315
            ..|:.:|.||:|.|:..........::..|: ..||.. ..|..:.|:.|..|||.:.|
  Fly   192 PSGRSTCFGDAGSPLITKQDSTVVGISAFVA-SNGCTL-GLPAGFARITSALDWIHQRT 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 62/247 (25%)
Tryp_SPc 83..314 CDD:238113 64/249 (26%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 64/248 (26%)
Tryp_SPc 29..244 CDD:214473 62/246 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.