DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and TMPRSS11F

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_997290.2 Gene:TMPRSS11F / 389208 HGNCID:29994 Length:438 Species:Homo sapiens


Alignment Length:313 Identity:105/313 - (33%)
Similarity:160/313 - (51%) Gaps:37/313 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LATALGDLACATPSLR-SASDPEK---ILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRECA 70
            |.|....|....||.| :..|.:|   :||:...:|.:|          ..:|...||       
Human   154 LKTKQLSLTINKPSFRLTPIDSKKMRNLLNSRCGIRMTS----------SNMPLPASS------- 201

  Fly    71 ECSCGNINTRHRIVGGQETEVH-EYPWMIMLMWFGNFY-CGASLVNDQYALTAAHCVNGFYHRLI 133
                    :..|||.|:||.:. |:||...|...|:.: |||||:::.:.||||||   |:....
Human   202 --------STQRIVQGRETAMEGEWPWQASLQLIGSGHQCGASLISNTWLLTAAHC---FWKNKD 255

  Fly   134 TVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSEN 198
            ..:.:...........|.|.|.::::|..|.....::||||::.:..|.....:..||:|..|..
Human   256 PTQWIATFGATITPPAVKRNVRKIILHENYHRETNENDIALVQLSTGVEFSNIVQRVCLPDSSIK 320

  Fly   199 YAGQTAV-VTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDS 262
            ...:|:| |||:|::.:.|||.:||::..|..:|.:.|...:..:..||..|:|||::| |..|:
Human   321 LPPKTSVFVTGFGSIVDDGPIQNTLRQARVETISTDVCNRKDVYDGLITPGMLCAGFME-GKIDA 384

  Fly   263 CQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENT 315
            |:||||||: |..:.|.:.:.||||||:.||.|..|||||||..:.||||..|
Human   385 CKGDSGGPL-VYDNHDIWYIVGIVSWGQSCALPKKPGVYTRVTKYRDWIASKT 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 86/231 (37%)
Tryp_SPc 83..314 CDD:238113 88/233 (38%)
TMPRSS11FNP_997290.2 SEA 59..154 CDD:279699 105/313 (34%)
Tryp_SPc 205..432 CDD:214473 86/231 (37%)
Tryp_SPc 206..435 CDD:238113 88/233 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.