DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:325 Identity:91/325 - (28%)
Similarity:147/325 - (45%) Gaps:75/325 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLILATALGDLACATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRECAE 71
            |:|||.|:...|...|.||..|                          .|:|.            
  Fly     4 LIILALAVAASAFPEPELRHRS--------------------------REMPV------------ 30

  Fly    72 CSCGNINTRHRIVGGQETEVHEYPWMI----MLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRL 132
              .|:|.  .||.||....|.::|:.:    .|....:.:||.||:...:.||||||.:|.  :.
  Fly    31 --VGDIG--GRITGGSNAAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTAAHCTDGV--QS 89

  Fly   133 ITVRL---LEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRF---NEPVRLGIDMHPVC 191
            :||.|   :..:.:.:|..    ..|.::||..:::.|..:||:||:.   :...|:.    .|.
  Fly    90 VTVYLGATVRTSAEITHTV----SSSDIIIHSGWNSANLRNDISLIKIPATSSSSRIS----AVK 146

  Fly   192 MPTPSENYA---GQTAVVTGWGALSE-GGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICA 252
            :|:.|.:|:   |..||.:|||..|: ...::..||.|::.:::..:|..: ||.|.:||:.:|.
  Fly   147 LPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVITNTKCAQT-YGTSVVTDSTLCV 210

  Fly   253 GYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWG--EGCAKPNAPGVYTRVGSFNDWIAENT 315
            ...:  .|.:|.||||||:.:..|.:.   .|:.|:|  .||.| ..|..:|||.|:.|||..||
  Fly   211 ATTD--AKSTCNGDSGGPLVLKSSSEQ---IGLTSFGASAGCEK-GYPAAFTRVTSYLDWIKTNT 269

  Fly   316  315
              Fly   270  269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 73/244 (30%)
Tryp_SPc 83..314 CDD:238113 74/246 (30%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 73/244 (30%)
Tryp_SPc 38..268 CDD:238113 74/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.