DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG6462

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:356 Identity:94/356 - (26%)
Similarity:146/356 - (41%) Gaps:94/356 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FHLLLILATALGDLACATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGP--EVPAEWSSPAK 66
            |.|||:.:|           |..:|:|                 |:.:...|  |.|.:..:..:
  Fly    10 FFLLLLSST-----------LVKSSEP-----------------WLDTFEHPKEETPDDDDAIME 46

  Fly    67 R------ECAECSC------GN--INTRHRIVGGQETEVHEYPW----MIMLMWFGNFYCGASLV 113
            |      |.....|      ||  ...|.||.||:......:|:    :|.|.......||.||:
  Fly    47 RRWQLGYENFRLRCEKFEMEGNQTAAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLI 111

  Fly   114 NDQYALTAAHCV-NGFYHRLITVRLLEHNRQDS--HVKIVDRRVSRVLIHPKYSTRNFDSDIALI 175
            ..|:.||||||: :....::.|...:..:.:||  .:::..|   ..:|:|.|......||:|||
  Fly   112 TLQFVLTAAHCLTDAIAAKIYTGATVFADVEDSVEELQVTHR---DFIIYPDYLGFGGYSDLALI 173

  Fly   176 RFNEPVRLGIDMHPVCMPTP--SENY-AGQTAVVTGWGALSEGGPISD----TLQEVEVPILSQE 233
            |....||....:.|:.:...  .:|: .|:...::|||.|   |..:|    .||.::..::.||
  Fly   174 RLPRKVRTSEQVQPIELAGEFMHQNFLVGKVVTLSGWGYL---GDSTDKRTRLLQYLDAEVIDQE 235

  Fly   234 ECRNSNYGESKITDNMIC---AGYVEQ---------GGKDSCQGDSGGPMHVLGSGDAYQLAGIV 286
            .|              ||   .|.|.|         .|:.:|.||||||:.......:| |.|:.
  Fly   236 RC--------------ICYFLPGLVSQRRHLCTDGSNGRGACNGDSGGPVVYHWRNVSY-LIGVT 285

  Fly   287 SWG--EGCAKPNAPGVYTRVGSFNDWIAENT 315
            |:|  ||| :...|.||||:.::..||.:.|
  Fly   286 SFGSAEGC-EVGGPTVYTRITAYLPWIRQQT 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 73/256 (29%)
Tryp_SPc 83..314 CDD:238113 74/258 (29%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 73/256 (29%)
Tryp_SPc 77..314 CDD:238113 74/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457791
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.