DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG10477

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:241 Identity:73/241 - (30%)
Similarity:130/241 - (53%) Gaps:26/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMW---FGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQ 143
            ||..|.:...:::|:.:.|.:   .|:::||.|::.:.:.||||||..|  ...:|:......|.
  Fly    39 RITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKG--ASSVTIYYGSTVRT 101

  Fly   144 DSHVKIVDRRV--SRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSEN---YAGQT 203
            .:.:|   ::|  |:.:.|..|:.....:||:||: ...|...:.::.:.:|..:.:   |||||
  Fly   102 SAKLK---KKVSSSKFVQHAGYNAATLRNDISLIK-TPSVTFTVSINKIALPAIASSYSTYAGQT 162

  Fly   204 AVVTGWGALSEGG-PISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDS 267
            ||.:|||..|:.. .::..||..:..:::...|:.: :|.|.:|..:||...:.:  |.:|||||
  Fly   163 AVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKT-FGSSVVTSGVICVESINK--KSTCQGDS 224

  Fly   268 GGPMHVLGSGDAYQLAGIVSW--GEGCAKPNAPGVYTRVGSFNDWI 311
            |||:.:..     :|.|:.|:  .:||.| |||..:|||.|:.|||
  Fly   225 GGPLALNN-----RLIGVTSFVSSKGCEK-NAPAGFTRVTSYLDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 71/239 (30%)
Tryp_SPc 83..314 CDD:238113 72/240 (30%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 71/239 (30%)
Tryp_SPc 40..267 CDD:238113 72/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.