DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and mas

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster


Alignment Length:242 Identity:93/242 - (38%)
Similarity:135/242 - (55%) Gaps:13/242 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 RHRIVGGQETEVHEYPWMIMLMWFGNFY-CGASLVNDQYALTAAHCVNGFYHR--LITVRLLEHN 141
            |.|:|||::.|..|:.|.:.|:...|.| |||:|:..|:.|||||||......  .|.||:.:::
  Fly   800 RARVVGGEDGENGEWCWQVALINSLNQYLCGAALIGTQWVLTAAHCVTNIVRSGDAIYVRVGDYD 864

  Fly   142 --RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY-AGQT 203
              |:.........||:...||..::::..|:||||::.:....|...:..||:|....:: ||:.
  Fly   865 LTRKYGSPGAQTLRVATTYIHHNHNSQTLDNDIALLKLHGQAELRDGVCLVCLPARGVSHAAGKR 929

  Fly   204 AVVTGWGALSEGGPISDTLQEVEVPILSQEEC-RNSNYGESKI---TDNMICAGYVEQGGKDSCQ 264
            ..|||:|.:.|.|||...::|.|:||:|..|| |..|....||   ..:..|||..|  |.|:||
  Fly   930 CTVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKVNAVTEKIFILPASSFCAGGEE--GHDACQ 992

  Fly   265 GDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            ||.|||: |......|:|||:||||.||.:.:.||||.:..||..||
  Fly   993 GDGGGPL-VCQDDGFYELAGLVSWGFGCGRQDVPGVYVKTSSFIGWI 1038

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 90/238 (38%)
Tryp_SPc 83..314 CDD:238113 91/239 (38%)
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 91/239 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.