DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG14990

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:348 Identity:95/348 - (27%)
Similarity:158/348 - (45%) Gaps:65/348 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FHLLLILATALGDLACATPSLRSA--------SDPEKI--LNNLAQLRQSSFLDWIQSILGPEVP 58
            |.|:..|.:|.|......|.:.:.        .||.::  ::|...|           :...:||
  Fly    10 FLLVSFLCSATGQNEGGAPGIFNGMSFTENLQPDPNQVCGMSNPNGL-----------VANVKVP 63

  Fly    59 AEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAH 123
            .::|:|.                           ::||::.|...|.::...||:..:..||||.
  Fly    64 KDYSTPG---------------------------QFPWVVALFSQGKYFGAGSLIAPEVVLTAAS 101

  Fly   124 CVNGFYHRLITVRLLEHN--RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGID 186
            .|.|.....|.||..|.|  ::...:...||.|:||:.|.::|.....::|||:....|..|...
  Fly   102 IVVGKTDAEIVVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSH 166

  Fly   187 MHPVCMPTPSENYAGQTAVVTGWGALS-EGGPISDTLQEVEVPILSQEEC----RNSNYGES-KI 245
            :..:|:|:...::..:..:|||||.:: .....|:..:::|:|::::.:|    ||:..|.| .:
  Fly   167 IRTICLPSQGRSFDQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDL 231

  Fly   246 TDNMICAGYVEQGGKDS--CQGDSGGPMHVLGSGD--AYQLAGIVSWGEGCAKPNAPGVYTRVGS 306
            ..::||||    |.||:  |.||.|..:......|  .|:.||||:||.||.:.|.|.|||.|..
  Fly   232 PASLICAG----GEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEM 292

  Fly   307 FNDWIAENTRDACSCAQPEAAGE 329
            |.|||.|:.... |.:.|.|||:
  Fly   293 FRDWIYEHMAQN-SNSVPFAAGQ 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 73/240 (30%)
Tryp_SPc 83..314 CDD:238113 75/242 (31%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 77/263 (29%)
Tryp_SPc 67..297 CDD:214473 75/260 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457673
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.