DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and KLKB1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:277 Identity:100/277 - (36%)
Similarity:147/277 - (53%) Gaps:37/277 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 CSCGN-----INTRHRIVGGQETEVHEYPWMIML---MWFGNFYCGASLVNDQYALTAAHCVNG- 127
            |:.|:     ..|..|||||..:...|:||.:.|   :......||.||:..|:.||||||.:| 
Human   386 CNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGL 450

  Fly   128 -------FYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGI 185
                   .|..::.:..:..:...|.:|       .::||..|.....:.|||||:...|:....
Human   451 PLQDVWRIYSGILNLSDITKDTPFSQIK-------EIIIHQNYKVSEGNHDIALIKLQAPLNYTE 508

  Fly   186 DMHPVCMPTPSENYAGQTAV------VTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESK 244
            ...|:|:|:     .|.|:.      |||||...|.|.|.:.||:|.:|:::.|||: ..|.:.|
Human   509 FQKPICLPS-----KGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQ-KRYQDYK 567

  Fly   245 ITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFND 309
            ||..|:|||| ::||||:|:||||||: |......::|.||.|||||||:...|||||:|..:.|
Human   568 ITQRMVCAGY-KEGGKDACKGDSGGPL-VCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMD 630

  Fly   310 WIAENTRDACSCAQPEA 326
            ||.|.|:.:...||.::
Human   631 WILEKTQSSDGKAQMQS 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 91/245 (37%)
Tryp_SPc 83..314 CDD:238113 92/247 (37%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519
APPLE 303..386 CDD:128519 100/277 (36%)
Tryp_SPc 401..632 CDD:214473 91/245 (37%)
Tryp_SPc 402..632 CDD:238113 90/244 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42230
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.