DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG13430

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:245 Identity:84/245 - (34%)
Similarity:137/245 - (55%) Gaps:19/245 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGF---YHRLITVRLLEHNRQ 143
            |||||.||.:..:|..:.|.......||.::::....|||||||..:   .:.:|.....:..:.
  Fly    31 RIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYSKPQYYVIRAGSSDWTKG 95

  Fly   144 DSHVKIVDRRVSRVLIHPKY--STRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTA-- 204
            .|::     ||.:::.||::  .|| .::|||:::..:|:....|:.|:.:.| |::....||  
  Fly    96 GSYI-----RVKKIIPHPEFHDPTR-MNNDIAIVQLQQPLVYSQDIRPISLAT-SKDIIMPTAQL 153

  Fly   205 VVTGWG--ALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDS 267
            .|:|||  ::|:..| ...|:...|.:..|.:|..:.:|...:|:.|.||| .:.||:|||||||
  Fly   154 FVSGWGSTSISQMQP-EKRLRYTVVHLRDQNQCARNYFGAGTVTNTMFCAG-TQAGGRDSCQGDS 216

  Fly   268 GGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRD 317
            |||: |.......:|.||||||.|||....||:||:|.:::||||:...:
  Fly   217 GGPL-VTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTIEE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 81/237 (34%)
Tryp_SPc 83..314 CDD:238113 83/239 (35%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 81/237 (34%)
Tryp_SPc 32..262 CDD:238113 83/239 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3952
SonicParanoid 1 1.000 - - X11
43.840

Return to query results.
Submit another query.