DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG32269

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:326 Identity:103/326 - (31%)
Similarity:157/326 - (48%) Gaps:45/326 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CNFHLL--LILA--TALGDLACATPS-----LRSASDPEKI--LNNLAQLRQSSFLDWIQSILGP 55
            |.:.:|  |:||  |.||:...|...     |||.:..:::  ..|...:|.:......:.:...
  Fly    27 CEYLILGMLLLAELTQLGEAVTANQQRRNRRLRSDNGTKRLTGTKNQTGIRSNRRQGTARKLSAK 91

  Fly    56 EVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALT 120
            .|      ...::.|..|    ..:.|||||..|.:...|:::.|. .|:..|..||:.:|:.||
  Fly    92 RV------NQNKKAATSS----KIQSRIVGGTSTTISTTPYIVQLR-RGSNLCSGSLITEQWVLT 145

  Fly   121 AAHCVNGFYHRLITVR--LLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRL 183
            |||||.|:.....|||  ....:..|.    |.|.||.:.:.||::::..:.|.||::.|:.: .
  Fly   146 AAHCVKGYSASDFTVRGGTTTLDGSDG----VTRSVSSIHVAPKFTSKKMNMDAALLKLNQSL-T 205

  Fly   184 GIDMHPVCMPTPSENY---AGQTAVVTGWGALSEGG-PISDTLQEVEVPILSQEECRNSNYGESK 244
            |.::..:.|    .||   ||....:.|||...||. ..|.|||..::.::.|::||....|::.
  Fly   206 GTNIGTISM----GNYRPKAGSRVRIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQAT 266

  Fly   245 ITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFND 309
            ||..|:||   ...|||||.||||||:....:     |.||||:|.|||:...|||||.|.:...
  Fly   267 ITKYMLCA---RAAGKDSCSGDSGGPVTRNNT-----LLGIVSFGYGCARAGYPGVYTAVVAIRQ 323

  Fly   310 W 310
            |
  Fly   324 W 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 86/235 (37%)
Tryp_SPc 83..314 CDD:238113 85/234 (36%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 85/233 (36%)
Tryp_SPc 121..324 CDD:238113 79/220 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.