DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG30414

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:288 Identity:85/288 - (29%)
Similarity:127/288 - (44%) Gaps:59/288 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 ECSCGNINTRH--RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCV-------- 125
            :.|||......  .|.||.:..:...|||:.::  |...||.||:..::.||||||:        
  Fly    27 DSSCGTTKPEFIPMITGGADAGLFSNPWMVKVL--GEKLCGGSLITSRFVLTAAHCIVSTHMRVR 89

  Fly   126 NGFY----------------HRLITVRLLEHNR----QDSHV-KIVDRRVSRVLIHPKYSTRNFD 169
            .|.|                ::|..:||.|::.    :|..| |..:..|.|.::|..|:. |.|
  Fly    90 LGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKILHADYNL-NLD 153

  Fly   170 SDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAV--VTGWGALSEGGPISDTLQEVEVPILSQ 232
            :||.|:|....|:....:.|:|:..  |.:..::.:  :||||..::|.| |..||...|.....
  Fly   154 NDIGLLRMKSFVQYSDYVRPICLLV--EGHMAESPIFNITGWGVTNDGTP-SRRLQRATVYNTDL 215

  Fly   233 EECRNSNYGESKIT----DNMICAGYVEQGGKDSCQGDSGGPMHV----LGSGDAYQLAGIVSWG 289
            ..||      ||.|    ::.|||...   ..|:|.||||||:..    .||...:|. |:||:|
  Fly   216 HFCR------SKFTKQVDESQICAAGT---NSDACHGDSGGPLSAQVPFAGSWLTFQY-GLVSYG 270

  Fly   290 EGCAKPNAPGVYTRVGSFNDWIAENTRD 317
            .  |..::..|||.|....|||.....|
  Fly   271 S--AACHSFSVYTNVTHHRDWIVNAIED 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 79/267 (30%)
Tryp_SPc 83..314 CDD:238113 81/269 (30%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 79/266 (30%)
Tryp_SPc 41..290 CDD:238113 79/266 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.