DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Prss48

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:263 Identity:99/263 - (37%)
Similarity:143/263 - (54%) Gaps:29/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCV-NGFY 129
            |::..:..||......||||||:..:..:||.:.|.:.....||.||::|.:.||||||: ..:|
Mouse    23 KKKNLQSVCGRPVHTGRIVGGQDAALGRWPWQVSLRFDYTHSCGGSLISDHWVLTAAHCIKKTWY 87

  Fly   130 HRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPT 194
            ..|.:|.|...:|:.|... .:..|||:.|..|:  |:.::||||::.:..|.....:.|:|:| 
Mouse    88 SFLYSVWLGSIDREYSSTG-KEYYVSRIAIPDKH--RHTEADIALLKLSSRVTFSSVILPICLP- 148

  Fly   195 PSENYAGQTAV-----VTGWGALSEGGPISDTLQEVEVPILSQEECRN--SNYG------ESKIT 246
               |.:.|..|     |||||...| |....||||:|||::|.|.|..  :..|      |..|.
Mouse   149 ---NISKQLTVPASCWVTGWGQNQE-GHYPSTLQELEVPVISSEACEQLYNPIGVFLPDLERVIK 209

  Fly   247 DNMICAGYVEQGGKDSCQGDSGGPM--HVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFND 309
            ::|.||| ..|..||||:||||||:  |:.|   .::|.|:||||..|.| :.|||||.|..:..
Mouse   210 EDMFCAG-ERQSRKDSCKGDSGGPLSCHIDG---VWRLMGVVSWGLECGK-DLPGVYTNVTYYQK 269

  Fly   310 WIA 312
            ||:
Mouse   270 WIS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 94/244 (39%)
Tryp_SPc 83..314 CDD:238113 95/246 (39%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 94/244 (39%)
Tryp_SPc 40..274 CDD:238113 95/246 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.