DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG8299

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:250 Identity:89/250 - (35%)
Similarity:136/250 - (54%) Gaps:30/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 NINTRHRIVGGQETEVHEYPWMI-------MLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLI 133
            :|:|  .||||.:.::.::|:.:       ||:    ..||.|:...:..:|||||:.|.|...|
  Fly    23 SIST--HIVGGDQADIADFPYQVSVRLETYMLL----HICGGSIYAPRVVITAAHCIKGRYASYI 81

  Fly   134 TVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHP--VCMPTPS 196
            .:...:::..|...:.|  :||:::.|..|:.:.:.:||.||...||:.....:.|  |.:..|.
  Fly    82 RIVAGQNSIADLEEQGV--KVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVALEAPP 144

  Fly   197 ENYAGQTAVVTGWGALSEGG-PISDTLQEVEVPILSQEECRNSNY--GESKITDNMICAGYVEQG 258
               :|..|||:|||..:|.. .:...|:.||:.|:.:..| .:.|  .:..:||.|:||||:| |
  Fly   145 ---SGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTC-GAQYLTKDYTVTDEMLCAGYLE-G 204

  Fly   259 GKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAE 313
            |||:|.||||||:.|.|     .|.|:||||.||.:...|||||.|.|..|||.|
  Fly   205 GKDTCNGDSGGPLAVDG-----VLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 84/240 (35%)
Tryp_SPc 83..314 CDD:238113 86/242 (36%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 84/240 (35%)
Tryp_SPc 28..255 CDD:238113 86/242 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.