DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Prss56

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_003750778.1 Gene:Prss56 / 363274 RGDID:1563955 Length:607 Species:Rattus norvegicus


Alignment Length:352 Identity:125/352 - (35%)
Similarity:171/352 - (48%) Gaps:43/352 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLILA----TALGD-----LACATPSLRSASDPEKILNNLAQLRQSSFLDW--------IQ--- 50
            |||:|:    ||.|.     |:.:|..:.||...:.:     |..|.| :.|        ||   
  Rat    11 LLLLLSPDSQTANGHPLYMRLSPSTLQVLSAQGTQAL-----QAAQRS-VQWAIKHVSMEIQHRR 69

  Fly    51 -SILGPEVPAEWSS------PAKRECAE--CSCGNINTRH-RIVGGQETEVHEYPWMIMLMWFGN 105
             ...||..|...:|      |....|.|  .|..|....| |||||....:..:||::.|...|.
  Rat    70 HECQGPGRPRPQASVFQDPPPEPGPCGERRQSVANTTRAHGRIVGGSTAPLGAWPWLVRLQLGGL 134

  Fly   106 FYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDS 170
            ..||..||...:.||||||..|..:.|:...:|....|....:.|  :|:|:|.|||:..:.|.:
  Rat   135 PLCGGVLVAASWVLTAAHCFAGASNELLWTVMLAEGPQGEQAEEV--QVNRILPHPKFDPQTFHN 197

  Fly   171 DIALIRFNEPVRLGIDMHPVCMPTPS-ENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEE 234
            |:||::...||.......|:|:|..| |..||....:.|||||.|.||.|:.::|..||:||.:.
  Rat   198 DLALVQLWTPVNSEGPARPICLPEGSREPPAGTPCTIAGWGALFEDGPESEAVREARVPLLSADT 262

  Fly   235 CRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQ--LAGIVSWGEGCAKPNA 297
            |:.: .|.......|:||||: .||.||||||||||:.....|...:  |.|:.|||:||.:|..
  Rat   263 CQKA-LGPGLSPSTMLCAGYL-AGGIDSCQGDSGGPLTCSEPGPRPREVLFGVTSWGDGCGEPGK 325

  Fly   298 PGVYTRVGSFNDWIAENTRDACSCAQP 324
            |||||||..|.||:.|......|..:|
  Rat   326 PGVYTRVAVFKDWLQEQMSAGPSTREP 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 94/231 (41%)
Tryp_SPc 83..314 CDD:238113 94/233 (40%)
Prss56XP_003750778.1 Tryp_SPc 112..342 CDD:238113 94/233 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 174 1.000 Domainoid score I3569
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.