DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and etaTry

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:251 Identity:94/251 - (37%)
Similarity:136/251 - (54%) Gaps:40/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIML---MWFGNFY---CGASLVNDQYALTAAHCVNGFYHRLITVRLLEH 140
            |||||.:|..:...:::.|   ....:.|   ||..:::.....||||||              :
  Fly    27 RIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAAHCV--------------Y 77

  Fly   141 NRQDSHVKIVDR------------RVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMP 193
            ||:..:..:|..            |||:::.|..|::...|:||||:..:.|:.|........:.
  Fly    78 NREAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPLDSFSTMEAIE 142

  Fly   194 TPSENYA-GQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQ 257
            ..||..| |..|.::|||...|.|..||.||:|:|||:..|:|:.:.|.. .|::.|:||| :.:
  Fly   143 IASEQPAVGVQATISGWGYTKENGLSSDQLQQVKVPIVDSEKCQEAYYWR-PISEGMLCAG-LSE 205

  Fly   258 GGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAE 313
            ||||:||||||||:.|     |.:||||||||||||:||.||||..|..:.||||:
  Fly   206 GGKDACQGDSGGPLVV-----ANKLAGIVSWGEGCARPNYPGVYANVAYYKDWIAK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 91/247 (37%)
Tryp_SPc 83..314 CDD:238113 93/250 (37%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 91/247 (37%)
Tryp_SPc 28..257 CDD:238113 93/250 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.