DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and lambdaTry

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster


Alignment Length:253 Identity:97/253 - (38%)
Similarity:131/253 - (51%) Gaps:42/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFY-HRLITVRLLEHN---- 141
            ||||||:|.:.:||..|.:.:.||..||.::......::||||||... ...:|:.....|    
  Fly    35 RIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFP 99

  Fly   142 ---RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALI------RFNEPVRLGIDMHPVCMPTPSE 197
               :|:..|:       .::|||||.|.|.|.|.|::      .||:.|:      |:.:.....
  Fly   100 TGPQQELEVR-------EIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQ------PIELAKERP 151

  Fly   198 NYAGQTAV-VTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKD 261
            ::  .|.| |||||..||||.|||.||||.|.::....|:|:.  ...:|..|:||| |..||||
  Fly   152 DH--DTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAY--SIMLTSRMLCAG-VNGGGKD 211

  Fly   262 SCQGDSGGPMHVLGSGDAYQ--LAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRD 317
            :||||||||:       .|.  |.||||||.|||:...||||..|....||:.|...|
  Fly   212 ACQGDSGGPL-------VYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVAD 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 94/245 (38%)
Tryp_SPc 83..314 CDD:238113 94/247 (38%)
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 93/244 (38%)
Tryp_SPc 36..259 CDD:238113 94/247 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.810

Return to query results.
Submit another query.