DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Np

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster


Alignment Length:241 Identity:108/241 - (44%)
Similarity:148/241 - (61%) Gaps:13/241 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIML-MWFGNFY---CGASLVNDQYALTAAHCVNGFYHRLITVRLLEHN- 141
            |||||.......:||.|.| .|..:.|   |||:|:|:.:|:||||||:......:.:||.|:: 
  Fly   797 RIVGGANAAFGRWPWQISLRQWRTSTYLHKCGAALLNENWAITAAHCVDNVPPSDLLLRLGEYDL 861

  Fly   142 -RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAV 205
             .::......:|||..|..||::..|.|:.|:||:||.|||....::.|||:|...||:.||||.
  Fly   862 AEEEEPYGYQERRVQIVASHPQFDPRTFEYDLALLRFYEPVIFQPNIIPVCVPDNDENFIGQTAF 926

  Fly   206 VTGWGALSEGGPISDTLQEVEVPILSQEEC----RNSNYGESKITDNMICAGYVEQGGKDSCQGD 266
            |||||.|.|.||:...||||.||:::...|    |::.|.| .|....||||: ::||.|||:||
  Fly   927 VTGWGRLYEDGPLPSVLQEVAVPVINNTICESMYRSAGYIE-HIPHIFICAGW-KKGGYDSCEGD 989

  Fly   267 SGGPMHVLGSGD-AYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            |||||.:....| .:.|.|::|||.|||:.|.||||||:..|.|||
  Fly   990 SGGPMVLQRESDKRFHLGGVISWGIGCAEANQPGVYTRISEFRDWI 1035

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 106/239 (44%)
Tryp_SPc 83..314 CDD:238113 107/240 (45%)
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 106/239 (44%)
Tryp_SPc 798..1038 CDD:238113 107/240 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.810

Return to query results.
Submit another query.