DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG8586

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster


Alignment Length:317 Identity:90/317 - (28%)
Similarity:142/317 - (44%) Gaps:60/317 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SILGPEV-PAEWSSPAKRECA--------------------ECSCGNINTRHRIVG------GQE 88
            |::.|.: |.:.|....|.||                    ..:||..|.:..|..      .::
  Fly   128 SLINPRISPIQCSKSLYRCCAVDQKVDDSESPYLVKQANFKYKNCGYSNPKGLIPDNDKFPYSED 192

  Fly    89 TEVH-EYPWMIMLMWFG--NFYCGASLVNDQYALTAAH-CVNGFYHRLITVRLLEHNRQDSHVKI 149
            ..:. |:|||:.: :.|  .|.||.:|::.:..:|.:| .||.      ||..|.....|..:..
  Fly   193 VSIFGEFPWMVGI-FTGRQEFLCGGTLIHPRLVVTTSHNLVNE------TVDTLVARAGDWDLNS 250

  Fly   150 VDR-------RVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTP-SENYAGQ---- 202
            ::.       |:..:::|.::...:..:||||:..:||:||...:.|:|:|.| |.....|    
  Fly   251 LNEPYPHQGSRIKEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLPPPESPELTNQLLSV 315

  Fly   203 TAVVTGWGALSEGG-PISDTLQEVEVPILSQEEC----RNSNY-GESKITDNMICAGYVEQGGKD 261
            |...||||....|. .:...|:.:.:|::.:|||    ||:.. ...::..:.||||  ...|||
  Fly   316 TCYATGWGTKEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAG--GDPGKD 378

  Fly   262 SCQGDSGGPM--HVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTR 316
            :|:||.|.|:  .:.|..|.|||.||||||..||..:.|.||..|.....||.|..|
  Fly   379 TCKGDGGSPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWIDEKIR 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 76/258 (29%)
Tryp_SPc 83..314 CDD:238113 78/260 (30%)
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 77/244 (32%)
Tryp_SPc 197..430 CDD:214473 75/241 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457467
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.