DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and scaf

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:275 Identity:75/275 - (27%)
Similarity:113/275 - (41%) Gaps:70/275 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNINTRHRIVGGQETEVH--EYPWMIMLMWFGN--FYCGASLVNDQYALTAAHCVNGFYHRLIT 134
            |...|.|.:..|.::.:.:  |.||..|::...:  ..||.:::.||:.|::|.||||.....|.
  Fly   412 CATRNKRTKPTGVKDLDANFAEIPWQAMILRESSKTLICGGAIIGDQFVLSSASCVNGLPVTDIR 476

  Fly   135 VRLLEHNR---------QDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPV 190
            |:..|...         |.:.||.||       :||.|.......|:|:||....:.....:.|:
  Fly   477 VKAGEWELGSTNEPLPFQLTGVKTVD-------VHPDYDPSTNSHDLAIIRLERRLEFASHIQPI 534

  Fly   191 CM----PTPSENYAGQTAVVTGWG--ALS---EGG--PISDTLQEVEVPILSQEECRNSNYGESK 244
            |:    |..||.     ...:|||  |||   ||.  .::|||.:      ::.||        .
  Fly   535 CISDEDPKDSEQ-----CFTSGWGKQALSIHEEGALMHVTDTLPQ------ARSEC--------S 580

  Fly   245 ITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIV----SWGEG----CAKPNAPGVY 301
            ...:.:|:.    ...||||.|.|..: ..|||.:.:|.||.    |.|||    .|||:...: 
  Fly   581 ADSSSVCSA----TKFDSCQFDVGSAL-ACGSGSSVRLKGIFAGENSCGEGQTVRFAKPDIKWI- 639

  Fly   302 TRVGSFNDWIAENTR 316
                  |...|||.:
  Fly   640 ------NTAFAENNK 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 69/260 (27%)
Tryp_SPc 83..314 CDD:238113 70/262 (27%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 58/218 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.