DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Prss21

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_006245934.1 Gene:Prss21 / 353251 RGDID:727870 Length:337 Species:Rattus norvegicus


Alignment Length:330 Identity:111/330 - (33%)
Similarity:163/330 - (49%) Gaps:62/330 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLILATALGDLACATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRECAE 71
            ||::..|:.....:|.|.....||||     .:|::::.|.      ||                
  Rat    11 LLVVVVAVEVTLQSTSSHVKPVDPEK-----PELQEANLLS------GP---------------- 48

  Fly    72 CSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCV---NGFYHRLI 133
              ||:.....|||||:|.|:..:||...|..:||..|||:|:|.::.||||||.   |..:.  .
  Rat    49 --CGHRTIPSRIVGGEEAELGRWPWQGSLRVWGNHLCGATLLNRRWVLTAAHCFQKDNDPFD--W 109

  Fly   134 TVRLLEHNRQDS--HVKIVDRR--VSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPT 194
            ||:..|...:.|  :::....|  :..:.:.||| |..|..||||::.:.||.....:.|:|:..
  Rat   110 TVQFGELTSRPSLWNLQAYSNRYQIEDIFLSPKY-TEQFPHDIALLKLSSPVTYSNFIQPICLLN 173

  Fly   195 PSENYAGQT-AVVTGWGALSEGG--PISDTLQEVEVPILSQEECRNSNYGESK------ITDNMI 250
            .:..:|.:| ..||||||:.|..  |:.:.||||:|.|::...|   |:...|      |..:|:
  Rat   174 STYKFANRTDCWVTGWGAIGEDESLPLPNNLQEVQVAIINNTMC---NHLFKKPDFRINIWGDMV 235

  Fly   251 CAGYVEQGGKDSC---------QGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGS 306
            |||..| ||||:|         |||||||: |......:...|:||||.||.:||.|||||.:..
  Rat   236 CAGSPE-GGKDACFAKLTYAAPQGDSGGPL-VCNQDTVWYQVGVVSWGIGCGRPNRPGVYTNISH 298

  Fly   307 FNDWI 311
            ..:||
  Rat   299 HYNWI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 94/253 (37%)
Tryp_SPc 83..314 CDD:238113 95/254 (37%)
Prss21XP_006245934.1 Tryp_SPc 57..303 CDD:214473 94/253 (37%)
Tryp_SPc 58..304 CDD:238113 95/254 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.