DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG4793

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:298 Identity:84/298 - (28%)
Similarity:136/298 - (45%) Gaps:58/298 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNINTRHRI-VGGQETEVH------EYPWMIML------MWFGNFYCGASLVNDQYALTAAHCV 125
            ||::|   || ||...|...      |.|||:.|      :..|    |.||:.....||::...
  Fly    86 CGHVN---RIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLG----GGSLITRDVVLTSSTKT 143

  Fly   126 NGFYHRLITVRLLEHN-----RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGI 185
            .....:.:.||..|.:     .:.:|..:..|::.|   |...|..|..::.||:....|::|..
  Fly   144 LEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVR---HTNLSVENGANNAALLFLARPLKLDH 205

  Fly   186 DMHPVCMPTPSENYAGQTAVVTGWG---ALSEGGPISDTLQEVEVPILSQEECR---NSNYGESK 244
            .:..:|:|.|:.|:.....:|:|||   ||...  ..:.|:::|:|::.:..|:   ...||:..
  Fly   206 HIGLICLPPPNRNFIHNRCIVSGWGKKTALDNS--YMNILKKIELPLVDRSVCQTKLQGPYGKDF 268

  Fly   245 ITDN-MICAGYVEQGGKDSCQGDSGGPM--HVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGS 306
            |.|| :||||  .:.|||:|:||.|.|:  .:....:.|:|.|||::|.||..| .|..||.|..
  Fly   269 ILDNSLICAG--GEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCGGP-LPAAYTDVSQ 330

  Fly   307 FNDWIAENTRDACSCAQPEA---------AGEPASPME 335
            ...||.       :|.|.||         .|:..:|::
  Fly   331 IRSWID-------NCIQAEAVHYSPQLGNVGQSPAPLD 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 73/255 (29%)
Tryp_SPc 83..314 CDD:238113 74/257 (29%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 70/250 (28%)
Tryp_SPc 105..335 CDD:214473 68/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457685
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.