DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:258 Identity:109/258 - (42%)
Similarity:149/258 - (57%) Gaps:20/258 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNIN----TRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCV---NGFYHR 131
            |||.|    .:.|||||.....||:||:.:|...|..:||.||:.:.:.|||||||   ..:...
  Fly   387 CGNKNPVTPDQERIVGGINASPHEFPWIAVLFKSGKQFCGGSLITNSHILTAAHCVARMTSWDVA 451

  Fly   132 LITVRLLEHN-RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPT- 194
            .:|..|.::| ..|..|:.|.||:.|::.|..:......:|:|::..:|||....::.|:|:|| 
  Fly   452 ALTAHLGDYNIGTDFEVQHVSRRIKRLVRHKGFEFSTLHNDVAILTLSEPVPFTREIQPICLPTS 516

  Fly   195 PSE---NYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESK---ITDNMICAG 253
            ||:   :|:||.|.|.|||:|.|.||....||:|::||.:..||.. .||.:.   |.::|||||
  Fly   517 PSQQSRSYSGQVATVAGWGSLRENGPQPSILQKVDIPIWTNAECAR-KYGRAAPGGIIESMICAG 580

  Fly   254 YVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTR 316
               |..||||.||||||| |:..|..|...||||||.||.|...|||||||.|...||.:|.:
  Fly   581 ---QAAKDSCSGDSGGPM-VINDGGRYTQVGIVSWGIGCGKGQYPGVYTRVTSLLPWIYKNIK 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 102/239 (43%)
Tryp_SPc 83..314 CDD:238113 103/241 (43%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 102/239 (43%)
Tryp_SPc 400..637 CDD:238113 103/241 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44284
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
65.910

Return to query results.
Submit another query.