DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Phae2

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:249 Identity:79/249 - (31%)
Similarity:122/249 - (48%) Gaps:29/249 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRL--------ITVRLL 138
            |:|||:....:..|:::.:.:.|..||.|:::|..:.:|||||:......|        |.|...
  Fly    31 RVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLANRNQVLGSTLVAGSIAVAGT 95

  Fly   139 EHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQT 203
            ....|       .|:::..:|:..|:......||.||...........:.||.:|:......|: 
  Fly    96 ASTTQ-------KRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSGVRPTGK- 152

  Fly   204 AVVTGWGALSEGGPIS--DTLQEVE-VPILSQEECRNS--NYGESKITDNMICAGYVEQGGKDSC 263
            |.:.|||:.|:....|  .||||.: :||:|.:.|..:  :.|:...|.| :|.|.: .||...|
  Fly   153 ADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTN-LCTGPL-TGGTSFC 215

  Fly   264 QGDSGGPMHVLGSGDAYQLAGIVSWGE-GCAKPNAPGVYTRVGSFNDWIAENTR 316
            ..|||||: |.|:    .|.||||||: .|.:||:|.||.:|.||..|||.|.:
  Fly   216 TSDSGGPL-VQGN----VLIGIVSWGKLPCGQPNSPSVYVQVSSFITWIAANQK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 75/242 (31%)
Tryp_SPc 83..314 CDD:238113 77/244 (32%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 75/242 (31%)
Tryp_SPc 32..262 CDD:238113 77/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.