DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Phae1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster


Alignment Length:239 Identity:75/239 - (31%)
Similarity:112/239 - (46%) Gaps:13/239 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSH 146
            |:|||....|:..|:.:.:.:.|..||.||::|..:.:|||||:......|.:..:......|..
  Fly    35 RVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNSNQVLGSTLVAGSIAVDGT 99

  Fly   147 VKIVD-RRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAVVTGWG 210
            ..... |.::..:|:..|:......||.:|...........:.||.:|:......| ||.:.|||
  Fly   100 ASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAVAPVTLPSSGVVPTG-TANLYGWG 163

  Fly   211 ALSEGGPIS--DTLQ-EVEVPILSQEECRNS-NYGESKITDNMICAGYVEQGGKDSCQGDSGGPM 271
            :.|.....|  .||| ...|||:|...|.:: ....|.:....:|.|.: .||...|..|||||:
  Fly   164 STSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTNLCTGPL-TGGVSICTSDSGGPL 227

  Fly   272 HVLGSGDAYQLAGIVSWGE-GCAKPNAPGVYTRVGSFNDWIAEN 314
             |.|:    .|.||||||: .|.:.|:|.||.:|.||..||:.|
  Fly   228 -VQGN----VLIGIVSWGKLPCGQANSPSVYVQVSSFISWISAN 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 72/234 (31%)
Tryp_SPc 83..314 CDD:238113 73/236 (31%)
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 72/234 (31%)
Tryp_SPc 36..266 CDD:238113 73/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.