DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CFI

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001362207.1 Gene:CFI / 3426 HGNCID:5394 Length:601 Species:Homo sapiens


Alignment Length:281 Identity:73/281 - (25%)
Similarity:113/281 - (40%) Gaps:43/281 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GDLACAT--PSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRECAECSCGNI 77
            |::.|.|  ..:..|:.....:...|.:.|..     ..||..::.|| ....|....:.|||..
Human   280 GEVDCITGEDEVGCAAARHPTIQGFASVTQEE-----TEILTADMDAE-RRRIKSLLPKLSCGVK 338

  Fly    78 NTRH----RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGF-YHRL-ITVR 136
            |..|    |||||:..::.:.||.:.:.......||...:...:.||||||:... .||. |...
Human   339 NRMHIRRKRIVGGKRAQLGDLPWQVAIKDASGITCGGIYIGGCWILTAAHCLRASKTHRYQIWTT 403

  Fly   137 LLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNE---------PVRLGIDMHPVCM 192
            :::....|.. :||...|.|::.|..|:...:.:|||||...:         |..:     |.|:
Human   404 VVDWIHPDLK-RIVIEYVDRIIFHENYNAGTYQNDIALIEMKKDGNKKDCELPRSI-----PACV 462

  Fly   193 P-TPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVE 256
            | :|.......|.:|:|||...:...:. :||..||.::|  .| :..||.......|.||    
Human   463 PWSPYLFQPNDTCIVSGWGREKDNERVF-SLQWGEVKLIS--NC-SKFYGNRFYEKEMECA---- 519

  Fly   257 QGGKDSCQ-GDSGGPMHVLGS 276
                |.|. ..:|...|.|.|
Human   520 ----DCCSVAQAGVQWHDLSS 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 57/208 (27%)
Tryp_SPc 83..314 CDD:238113 56/207 (27%)
CFINP_001362207.1 FIMAC 43..108 CDD:214493
SR 114..215 CDD:214555
LDLa 224..256 CDD:238060
Ldl_recept_a 257..293 CDD:365841 3/12 (25%)
Tryp_SPc 348..>519 CDD:238113 48/180 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.