DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and OVCH2

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_016873148.1 Gene:OVCH2 / 341277 HGNCID:29970 Length:569 Species:Homo sapiens


Alignment Length:272 Identity:90/272 - (33%)
Similarity:134/272 - (49%) Gaps:36/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SCGN----------INTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCV-N 126
            |||.          .|...||:||.:.|...|||.:.|.......||.|:|:.|:.:|||||: |
Human    36 SCGQSLVKVQPWNYFNIFSRILGGSQVEKGSYPWQVSLKQRQKHICGGSIVSPQWVITAAHCIAN 100

  Fly   127 GFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRN-FDSDIALIRFNEPVRLGIDMHPV 190
            ......:.|...|::...:........:..|:|||.:||:. .|.||||::.....:.|..:.|:
Human   101 RNIVSTLNVTAGEYDLSQTDPGEQTLTIETVIIHPHFSTKKPMDYDIALLKMAGAFQFGHFVGPI 165

  Fly   191 CMPTPSENY-AGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEEC-------RNSNYGESKITD 247
            |:|...|.: ||......|||.|:|||.:|..||||.:|||:.|||       :....|::    
Human   166 CLPELREQFEAGFICTTAGWGRLTEGGVLSQVLQEVNLPILTWEECVAALLTLKRPISGKT---- 226

  Fly   248 NMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAK----------PNAPGVYT 302
             .:|.|:.: ||:|:|||||||.:.......|:.|||:.|||.||.:          ..:||::|
Human   227 -FLCTGFPD-GGRDACQGDSGGSLMCRNKKGAWTLAGVTSWGLGCGRGWRNNVRKSDQGSPGIFT 289

  Fly   303 RVGSFNDWIAEN 314
            .:.....||.|:
Human   290 DISKVLPWIHEH 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 83/248 (33%)
Tryp_SPc 83..314 CDD:238113 84/250 (34%)
OVCH2XP_016873148.1 Tryp_SPc 55..298 CDD:214473 83/248 (33%)
Tryp_SPc 56..301 CDD:238113 84/250 (34%)
CUB 320..424 CDD:238001
CUB 435..546 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.