DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and PRSS38

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:271 Identity:92/271 - (33%)
Similarity:143/271 - (52%) Gaps:24/271 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRL 137
            :||..:...:|:||......::||.:.:.:.|...||.|::|:.:.|:||||    :||...:::
Human    50 ACGRPSMEGKILGGVPAPERKWPWQVSVHYAGLHVCGGSILNEYWVLSAAHC----FHRDKNIKI 110

  Fly   138 LEHNRQDSHVKIVDRR----------VSRVLIHPKYSTRN-FDSDIALIRFNEPVRLGIDMHPVC 191
                 .|.:|.:|:.|          |:||::||.|...: ...|:||::....:.....:.|||
Human   111 -----YDMYVGLVNLRVAGNHTQWYEVNRVILHPTYEMYHPIGGDVALVQLKTRIVFSESVLPVC 170

  Fly   192 MPTPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGE-SKITDNMICAGYV 255
            :.||..|........||||.:|:.|..||.|||:::|::.:..| :..||. |.|..:|:|||.:
Human   171 LATPEVNLTSANCWATGWGLVSKQGETSDELQEMQLPLILEPWC-HLLYGHMSYIMPDMLCAGDI 234

  Fly   256 EQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRDACS 320
             ...|..|:||||||: |.....::...||||||.||:.|..||||..|..|:.||.:|.....:
Human   235 -LNAKTVCEGDSGGPL-VCEFNRSWLQIGIVSWGRGCSNPLYPGVYASVSYFSKWICDNIEITPT 297

  Fly   321 CAQPEAAGEPA 331
            .|||..|..||
Human   298 PAQPAPALSPA 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 81/240 (34%)
Tryp_SPc 83..314 CDD:238113 83/242 (34%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 83/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.