DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Jon25Biii

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:251 Identity:77/251 - (30%)
Similarity:116/251 - (46%) Gaps:49/251 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLI----TVRLLEHNR 142
            ||..|......:.|:.:.|.:.|.::||.|::...:.|||.||:......::    |.|.   |.
  Fly    36 RITNGYAAPEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDAASVIVYFGATWRT---NA 97

  Fly   143 QDSHVKIVDRRVSRVLIHPKYSTRNF----DSDIALIRFNEPVRLGID----MHPVCMPTPSE-- 197
            |.:|.               ....||    ::||||||...     :|    ::.|.:|:.::  
  Fly    98 QFTHT---------------VGNGNFIKHSNADIALIRIPH-----VDFWHMVNKVELPSYNDRY 142

  Fly   198 -NYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKD 261
             ||....||..|||...:|.|:.|.||.|::.|:..||| ...||  .:.||:||...|:  ||.
  Fly   143 NNYNEWWAVACGWGGTYDGSPLPDWLQCVDLQIVHNEEC-GWTYG--SVGDNVICTRTVD--GKS 202

  Fly   262 SCQGDSGGPMHVLGSGDAYQLAGIVSW--GEGCAKPNAPGVYTRVGSFNDWIAENT 315
            .|.||||||   |.:.|..:|.|:.::  ..|| :..||..:.||....|||.::|
  Fly   203 ICGGDSGGP---LVTHDGSKLVGVSNFVSSNGC-QSGAPAGFQRVTYHLDWIRDHT 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 74/245 (30%)
Tryp_SPc 83..314 CDD:238113 75/247 (30%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 74/245 (30%)
Tryp_SPc 37..253 CDD:238113 75/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.