DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG31954

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:322 Identity:108/322 - (33%)
Similarity:159/322 - (49%) Gaps:54/322 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCNFHLLLILATALGDLA--CATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSS 63
            |....|.::|..:|..||  |..|      .|.|        ||.|..|.|::        .|..
  Fly     1 MLALRLFVLLQCSLLVLAGVCLIP------QPVK--------RQRSLEDVIKN--------PWKL 43

  Fly    64 PAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGF 128
            ..:.:            .|||||....:.:.|..:.|. ..:..||.|::::::.||||||..|.
  Fly    44 SPRLD------------GRIVGGHRINITDAPHQVSLQ-TSSHICGGSIISEEWILTAAHCTYGK 95

  Fly   129 YHRLITVRL--LEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVC 191
            ....:.|||  .|..|....:     ||.:::.|.:::..|.|.|.:|::...|::.......|.
  Fly    96 TADRLKVRLGTSEFARSGQLL-----RVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVK 155

  Fly   192 MPTPSENYA-GQTAVVTGWGALSEGGPISDTLQEVEVPILSQEEC--RNSNYGESKITDNMICAG 253
            :|.....|. |:...|:|||.........:.|::||||:::||.|  :...||  .:|:.|||||
  Fly   156 LPESQMKYMDGEACFVSGWGNTQNLLESREWLRQVEVPLVNQELCSEKYKQYG--GVTERMICAG 218

  Fly   254 YVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENT 315
            ::| ||||:||||||||| |..||   :|.|:||||.|||||:.||||:||....|||.|::
  Fly   219 FLE-GGKDACQGDSGGPM-VSESG---ELVGVVSWGYGCAKPDYPGVYSRVSFARDWIKEHS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 89/233 (38%)
Tryp_SPc 83..314 CDD:238113 90/235 (38%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 89/233 (38%)
Tryp_SPc 51..274 CDD:238113 90/235 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.