DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and prss60.3

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:275 Identity:102/275 - (37%)
Similarity:150/275 - (54%) Gaps:11/275 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNINTRHRIVGGQETEVHEYPWMIML--MWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVR 136
            ||......|||||.......:||.:.|  ..:|..:||.||::.::.||||||::|.....:.|.
Zfish    27 CGQAPLNTRIVGGVNASPGSWPWQVSLHSPKYGGHFCGGSLISSEWVLTAAHCLSGVSETTLVVY 91

  Fly   137 LLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY-A 200
            |....:|..::....|.|::..:|..|::...|:||||:|.:..|.....:.|||:...:..| |
Zfish    92 LGRRTQQGINIYETSRNVAKSFVHSSYNSNTNDNDIALLRLSSAVTFTNYIRPVCLAAQNSVYSA 156

  Fly   201 GQTAVVTGWGALSEGG--PISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSC 263
            |.::.:||||.:..|.  |....|||..:|:::.:.| |:..|...:|:|||||| :.|||||:|
Zfish   157 GTSSWITGWGDIQAGVNLPAPGILQETMIPVVANDRC-NALLGSGTVTNNMICAG-LTQGGKDTC 219

  Fly   264 QGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAEN---TRDACSCAQPE 325
            |||||||| |......:..|||.|||.|||.||:|||||||..:..||:..   .:.......|.
Zfish   220 QGDSGGPM-VTRLCTVWVQAGITSWGYGCADPNSPGVYTRVSQYQSWISSKISLNKPGFILFTPP 283

  Fly   326 AAGEPASPMETTEQG 340
            ::...||.:.|:..|
Zfish   284 SSCSSASRISTSCSG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 93/233 (40%)
Tryp_SPc 83..314 CDD:238113 94/235 (40%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 94/235 (40%)
Somatomedin_B 294..328 CDD:321959 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587884
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.