DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG3117

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster


Alignment Length:242 Identity:71/242 - (29%)
Similarity:122/242 - (50%) Gaps:20/242 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVK 148
            |.|.:|:.:::||:..|...|::..|.||:.....|||||.:.|.....|.||..|.:...|. |
  Fly    93 VFGDQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILAGLSPNDIMVRAGEWDLSSSE-K 156

  Fly   149 I---VDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAVVTGWG 210
            :   :||:|.:::.|..::..:..:|:||:..:.|..|..::..:.:|.|.:.:..:...|.|||
  Fly   157 LNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLPIPDKTFDRRICTVAGWG 221

  Fly   211 ALSEGGPISDTLQE-VEVPILSQEECR--------NSNYGESKITDNMICAGYVEQGGKDSCQGD 266
            ..|.......|:|: |::|::...:|:        .|||   ::..:::|||..|  |:|.|...
  Fly   222 MRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNY---QLPASLMCAGGEE--GRDVCSLF 281

  Fly   267 SGGPMHVLGSGD--AYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            .|..:......|  .|:.|||||:|.||.:.|.|..:|.|..|.:||
  Fly   282 GGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 69/240 (29%)
Tryp_SPc 83..314 CDD:238113 71/242 (29%)
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 70/240 (29%)
Tryp_SPc 95..328 CDD:214473 68/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457679
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.