DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG18557

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster


Alignment Length:312 Identity:79/312 - (25%)
Similarity:137/312 - (43%) Gaps:66/312 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 WIQSILGPEVPAEWSSPAKRECAEC------------SCGNINTRHRIVGGQETEV------HEY 94
            |.|:.:      .|.||.:|..:.|            :||..|...  :||...||      :|:
  Fly    39 WNQNAI------SWPSPCQRSESCCHSSQKLVIGAPLNCGKSNPNG--LGGTVEEVVDQAKPNEF 95

  Fly    95 PWMIMLMW-FGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHV----------- 147
            ||.:.||. ..||:...:||.:...:||||.            :|:....|..:           
  Fly    96 PWTVALMQNLINFFGAGTLVTENIVITAAHL------------MLDKTINDFGIIGGAWDLKQLA 148

  Fly   148 -KIVD-RRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAVVTGWG 210
             |.:. |..:|::.||.::.....::||||.......:...:.|:|.||...::..:..:|.|||
  Fly   149 GKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWPTSGVSFDRERCLVAGWG 213

  Fly   211 A---LSEGGPISDTLQEVEVPILSQEEC----RNSNYGES-KITDNMICAGYVEQGGKDSCQGDS 267
            .   |::.  .|...:::::||:|:.:|    |.:.:.:| ::...::|||  .:.|:|:|.||.
  Fly   214 RPDFLAKN--YSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAG--GERGRDACIGDG 274

  Fly   268 GGPM--HVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRD 317
            |.|:  .:.|....|:|.|||:.|..|...|.|.:||.:.....||.:...|
  Fly   275 GSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQLND 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 66/258 (26%)
Tryp_SPc 83..314 CDD:238113 68/260 (26%)
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 64/250 (26%)
Tryp_SPc 90..320 CDD:214473 62/245 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457703
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.