DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG4259

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster


Alignment Length:236 Identity:59/236 - (25%)
Similarity:97/236 - (41%) Gaps:26/236 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 YPWMIMLM----WFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHN----RQDSHVKIV 150
            :||::.::    |...:....||:|....|||||.:||.....:.||..|.:    ....|   |
  Fly    39 FPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQH---V 100

  Fly   151 DRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAVVTGWGAL--- 212
            |..|..::.|.:::..|.::::||:.......:..:::.:.:..........:....|||.:   
  Fly   101 DLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEAGIQKGSCFFNGWGKVYLN 165

  Fly   213 SEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPM--HVLG 275
            |...|  ..|:.|:|.:||...|     ...|:....||...:|  |.| |.||.|.|:  .:|.
  Fly   166 STDYP--TVLKTVQVDLLSMGMC-----SSRKLPIQQICGKGLE--GID-CSGDGGAPLVCRILT 220

  Fly   276 SGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTR 316
            ....|...|||:|.......|...|:|.|.....||..:.|
  Fly   221 YPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWIDYHLR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 56/229 (24%)
Tryp_SPc 83..314 CDD:238113 58/232 (25%)
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 58/232 (25%)
Tryp_SPc 39..256 CDD:214473 56/229 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457637
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.