DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Ser6

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:259 Identity:74/259 - (28%)
Similarity:125/259 - (48%) Gaps:45/259 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCV-NGFYHRLI----- 133
            |.:|  .|:|||::...:::|..:.|...|:..||.|::...|.||||||| |...:.:|     
  Fly    26 GKLN--GRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAA 88

  Fly   134 ---TVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTP 195
               |:|...::|....|.:   :|:.|::|.:|.  ||.:|:||:|...|:.|...:.|:.:|| 
  Fly    89 ERFTIRAGSNDRFSGGVLV---QVAEVIVHEEYG--NFLNDVALLRLESPLILSASIQPIDLPT- 147

  Fly   196 SENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGY------ 254
            .:..|....|::|||.:...|.:...||...:..:::::|           :.:|..|:      
  Fly   148 VDTPADVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQC-----------EELIDFGFEGELCL 201

  Fly   255 VEQGGKDSCQGDSGGPMHVLGSGDAY--QLAGIVSW-GEGCAKPNAPGVYTRVGSFNDWIAENT 315
            :.|....:|.||||||.       .|  ||.|:..: .:||.. ..|..|.||..|.|||.:::
  Fly   202 LHQVDNGACNGDSGGPA-------VYNNQLVGVAGFVVDGCGS-TYPDGYARVFYFKDWIKKHS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 70/246 (28%)
Tryp_SPc 83..314 CDD:238113 71/248 (29%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 70/246 (28%)
Tryp_SPc 32..256 CDD:238113 71/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457779
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.