DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG14227

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster


Alignment Length:266 Identity:64/266 - (24%)
Similarity:113/266 - (42%) Gaps:41/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 ECSCG-NINTRHRIVG----GQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYH 130
            :..|| ::.|..::..    ...|::...||::.::..|...|..||:|.::.|||||||   :.
  Fly    28 DAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIVNGKAKCSGSLINHRFVLTAAHCV---FR 89

  Fly   131 RLITVRLLEHNRQD-----------SHVKIVDRRVSRVLIHP---KYSTRNFDSDIALIRFNEPV 181
            ..:.|.|.:.:..:           |:...|  |:.:.::|.   |...:.:  ||.|:|....|
  Fly    90 EAMQVHLGDFDAWNPGQNCSSGARLSNAYCV--RIDKKIVHAGFGKIQAQQY--DIGLLRMQHAV 150

  Fly   182 RLGIDMHPVCMPTPSENYAGQTAVVTGWGALSEG-GPISDTLQEVEVPILSQEECRNSNYGESKI 245
            :....:.|:|:.......|.....:|.||..:|. ..|...|:......:.:|.|  :...:.::
  Fly   151 QYSDFVRPICLLINEPVAAIDRFQLTVWGTTAEDFRSIPRVLKHSVGDRIDRELC--TLKFQQQV 213

  Fly   246 TDNMICAGYVEQGGKDSCQGDSGGPMHVL----GSGDAYQLAGIVSWG-EGCAKPNAPGVYTRVG 305
            .::.||   |......:|:||||||....    |:...:|. ||:.:| ..||   ...|.|.|.
  Fly   214 DESQIC---VHTETSHACKGDSGGPFSAKILYGGTYRTFQF-GIIIFGLSSCA---GLSVCTNVT 271

  Fly   306 SFNDWI 311
            .:.|||
  Fly   272 FYMDWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 59/252 (23%)
Tryp_SPc 83..314 CDD:238113 61/253 (24%)
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 58/235 (25%)
Tryp_SPc 57..277 CDD:238113 58/235 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.