DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and TRY3_ANOGA

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_317171.2 Gene:TRY3_ANOGA / 3291693 VectorBaseID:AGAP008294 Length:268 Species:Anopheles gambiae


Alignment Length:236 Identity:96/236 - (40%)
Similarity:131/236 - (55%) Gaps:10/236 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 HRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDS 145
            ||||||.|.:|.|.|:.:.|.:|.:..||.|::|.::.||||||........:.|| |..:|..|
Mosquito    40 HRIVGGFEIDVSETPYQVSLQYFNSHRCGGSVLNSKWILTAAHCTVNLQPSSLAVR-LGSSRHAS 103

  Fly   146 HVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYA-GQTAVVTGW 209
            ...:|  ||:|||.||.|.....|.|.:|:.....:.....:.||.:|...|... |...:|:||
Mosquito   104 GGTVV--RVARVLEHPNYDDSTIDYDFSLMELESELTFSDVVQPVSLPDQDEAVEDGTMTIVSGW 166

  Fly   210 GALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVL 274
            |........:..|:...||.::|:||..:......|||.|:|||| ::||||:||||||||:.|.
Mosquito   167 GNTQSAAESNAILRAANVPTVNQKECTIAYSSSGGITDRMLCAGY-KRGGKDACQGDSGGPLVVD 230

  Fly   275 GSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENT 315
            |     :|.|:||||.|||.|..||||.||....||:.||:
Mosquito   231 G-----KLVGVVSWGFGCAMPGYPGVYARVAVVRDWVRENS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 92/229 (40%)
Tryp_SPc 83..314 CDD:238113 92/231 (40%)
TRY3_ANOGAXP_317171.2 Tryp_SPc 41..262 CDD:214473 92/229 (40%)
Tryp_SPc 42..265 CDD:238113 92/231 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.