DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP011914

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_552329.3 Gene:AgaP_AGAP011914 / 3291452 VectorBaseID:AGAP011914 Length:398 Species:Anopheles gambiae


Alignment Length:354 Identity:94/354 - (26%)
Similarity:150/354 - (42%) Gaps:88/354 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CNFHLLLILATALGD-------LACATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPA 59
            |.:..|.|  :..||       :.|.|.:....|...|:               :.::||    :
Mosquito    86 CYYDKLAI--SRFGDPNLSDAIVRCGTTTFNVESQYNKL---------------VVALLG----S 129

  Fly    60 EWSSPAKREC------AECSCGNINTRHR---IVGGQETEVHEYPWMIMLMW---FGNFYCGASL 112
            ..:|..:..|      ..|.||    |||   ||.|..|..:|||.|..| |   ....:||:::
Mosquito   130 TSTSGGRFRCQITALKLACDCG----RHRTPTIVNGFPTLTNEYPMMAGL-WDNSVSRVFCGSTI 189

  Fly   113 VNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKIVDRR--------------VSRVLIHPKY 163
            |.:::.||||||            ||:.....:.|.:.::.              ||..:.||.|
Mosquito   190 VTNRHVLTAAHC------------LLDRTAAGTRVLVGEQNTNITNETPYTLRMLVSTFIKHPSY 242

  Fly   164 STRNFDSDIALIRFNEPVRLGIDMHPVCMP----TPSENYAGQTAVVTGWGALSEGGPISDTLQE 224
            :..:..:||||::..:.:.....:..||:|    |.|...|..:|:  ||||:..|.|.|..|.:
Mosquito   243 NPTSKANDIALVQTFDTIVFNPGVGRVCLPFRFGTSSFENARLSAL--GWGAIDFGAPSSKELLQ 305

  Fly   225 VEVPILSQEECRNSNYGESKITDNMICAGYVE-QGGKDSCQGDSGGPMHVL--GSGDAYQLAGIV 286
            ..:.::|...|      .:|::..::.:.... ..|.|:||.|||||::..  .|...|.: |:|
Mosquito   306 TTLAVVSSTSC------GTKLSRTILASQMCTFAAGNDTCQNDSGGPLYYTDPNSQLVYSI-GVV 363

  Fly   287 SWGEGCAKPNAPGVYTRVGSFNDWIAENT 315
            .:|..||. :.|.|.|||.|:.|||:..|
Mosquito   364 GFGVACAS-SFPSVNTRVTSYLDWISSTT 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 73/255 (29%)
Tryp_SPc 83..314 CDD:238113 74/254 (29%)
AgaP_AGAP011914XP_552329.3 CUB 34..143 CDD:238001 13/77 (17%)
Tryp_SPc 158..390 CDD:238113 74/254 (29%)
Tryp_SPc 158..387 CDD:214473 72/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.