DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP001252

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_321900.3 Gene:AgaP_AGAP001252 / 3290448 VectorBaseID:AGAP001252 Length:271 Species:Anopheles gambiae


Alignment Length:274 Identity:89/274 - (32%)
Similarity:130/274 - (47%) Gaps:44/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QSILGPE-VPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLV 113
            :.:||.| .||    ||:            ...|||||.|..:.::|:.:.|.:.|...||||.|
Mosquito    17 EGVLGREAAPA----PAR------------ATGRIVGGWEVYIGQFPYQLSLEYDGYHICGASAV 65

  Fly   114 NDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIR-- 176
            ..:.||||.||..|.....:|||......::..:..   .|.:::|||.|...|.|.|:.::|  
Mosquito    66 APRLALTAGHCCIGTNETDLTVRGGSSTLEEGGIVF---PVKKLVIHPDYDDSNLDFDVCVLRIG 127

  Fly   177 --FNEPVRLGIDMHPVCMPTPSENY-AGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRN- 237
              |.....:||     ..||.|... :|:.|:||||||....|.....|:.:.|.:.|.:.|.: 
Mosquito   128 GTFQNKSNIGI-----IQPTSSGTIPSGELAIVTGWGATESNGNFVPNLRSLAVKVWSTKNCTDQ 187

  Fly   238 -SNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVY 301
             :||..|  :.:|:|||.|   |:..|.||||||:..    |..|: ||||:........||.:|
Mosquito   188 AANYMTS--SGSMMCAGSV---GRSFCVGDSGGPLVY----DQRQI-GIVSFLINECGGTAPAIY 242

  Fly   302 TRVG--SFNDWIAE 313
            ||:.  |..|:|.:
Mosquito   243 TRLSHRSVRDFIRQ 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 81/237 (34%)
Tryp_SPc 83..314 CDD:238113 81/240 (34%)
AgaP_AGAP001252XP_321900.3 Tryp_SPc 34..254 CDD:214473 81/237 (34%)
Tryp_SPc 35..257 CDD:238113 81/240 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.