DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP005689

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_556335.3 Gene:AgaP_AGAP005689 / 3290022 VectorBaseID:AGAP005689 Length:300 Species:Anopheles gambiae


Alignment Length:248 Identity:83/248 - (33%)
Similarity:128/248 - (51%) Gaps:20/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 HRIVGGQETEVHEYPWMIMLM---WFGNFYCGASLVNDQYALTAAHCVNGFYHRLIT--VRLL-E 139
            |||..|||....::|:.|.|:   ..||..||.|::...:.|||||||......|.:  |.:: .
Mosquito    54 HRITNGQEATPGQFPFQIALISEFASGNGLCGGSVLTRNFILTAAHCVVSGASTLASGGVAIMGA 118

  Fly   140 HNR--QDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSE--NYA 200
            |||  |:|..:.:....|.:..||.||:....:|||.:|.|.|:.....:.|:.:|..|:  .:.
Mosquito   119 HNRNIQESTQQRIRFATSGIRRHPSYSSSTLRNDIATVRLNSPMTFTTRIQPIRLPGRSDTRQFG 183

  Fly   201 GQTAVVTGWGALSEGGPISDTLQEVEV-PILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQ 264
            |.|..|:|:|..|:....:..:..... |:::..:| .:.:|.:.:..::..:|   .||:.||.
Mosquito   184 GFTGTVSGFGRTSDASSATSAVVRFTTNPVMTNTDC-IARWGSTVVNQHVCLSG---AGGRSSCN 244

  Fly   265 GDSGGPMHVLGSGDAYQLAGIVSWG--EGCAKPNAPGVYTRVGSFNDWIAENT 315
            ||||||:.| .||...|: |:||:|  .||| ...|.||.||..|.|||..|:
Mosquito   245 GDSGGPLTV-QSGGTMQI-GVVSFGSVNGCA-IGMPSVYARVTFFLDWIVANS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 79/241 (33%)
Tryp_SPc 83..314 CDD:238113 80/243 (33%)
AgaP_AGAP005689XP_556335.3 Tryp_SPc 55..290 CDD:214473 79/241 (33%)
Tryp_SPc 56..290 CDD:238113 78/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.