DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP005642

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_556287.3 Gene:AgaP_AGAP005642 / 3290013 VectorBaseID:AGAP005642 Length:313 Species:Anopheles gambiae


Alignment Length:244 Identity:72/244 - (29%)
Similarity:118/244 - (48%) Gaps:16/244 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIML---MWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRL--LEHN 141
            |||||......:.|:.:.:   :..|...||..|:::.:.|||..||......::.:..  |::.
Mosquito    69 RIVGGSIATAGQIPYQVAILSDLEAGQALCGGVLLSNNFVLTAGVCVENTSGGVVVLGALNLQNE 133

  Fly   142 RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSE--NYAGQTA 204
            .:...|:|. .....|.:|.::....|.::||.||.:|||.....:.||.:|..::  .:||..|
Mosquito   134 AEAGQVRIT-FAAGDVRLHEEFLAVIFRNNIAAIRLSEPVSFSDRIQPVRIPAAADGRTFAGALA 197

  Fly   205 VVTGWGALSEGG-PISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSG 268
            .|:|:|..|:.. ..||.|:.|..||::..:|..:.:| ..|....:|..|:|  .:..|.||.|
Mosquito   198 TVSGFGRTSDSSTSFSDVLRYVRNPIMTNADCFATAWG-GLIDGQKMCLHYME--ARAPCDGDVG 259

  Fly   269 GPMHVLGSGDAYQLAGIVSWGE--GCAKPNAPGVYTRVGSFNDWIAENT 315
            |||.|...|... |.|:.|:|.  || :.:.|.|:.|:..:..||..||
Mosquito   260 GPMTVADGGSTL-LVGLYSFGSVLGC-ESDWPAVFVRITFYRQWIVANT 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 68/238 (29%)
Tryp_SPc 83..314 CDD:238113 69/240 (29%)
AgaP_AGAP005642XP_556287.3 Tryp_SPc 69..302 CDD:214473 68/238 (29%)
Tryp_SPc 70..302 CDD:238113 67/237 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.