DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG33160

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:249 Identity:76/249 - (30%)
Similarity:126/249 - (50%) Gaps:40/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 NINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEH 140
            ::..:.||:||..:.:.|..:::.:. .....||.|||..::.:||||||              :
  Fly    27 SVQIQPRIIGGHVSSIKEEKYLVQVT-TSEELCGGSLVKPRWVITAAHCV--------------Y 76

  Fly   141 NRQDSHVKI------------VDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMP 193
            |:..:..||            |.|.|..:.|.|.::.:..:.|:|.:|.|..: :|.::..:  |
  Fly    77 NKNKNDFKIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDM-IGANIETI--P 138

  Fly   194 TPSENYAGQTAV-VTGWGAL-SEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVE 256
            ..:::...:..| |:|||.| ::....::.:..|.||:.|:..|.::..|..:||.:|:||..:.
  Fly   139 LAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLY 203

  Fly   257 QGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDW 310
            :  ||||.||||||:...|     |||||||:|.|||.. .||:||.|....||
  Fly   204 K--KDSCDGDSGGPLVYRG-----QLAGIVSFGYGCASA-LPGIYTSVPEIRDW 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 76/243 (31%)
Tryp_SPc 83..314 CDD:238113 75/242 (31%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 74/241 (31%)
Tryp_SPc 34..253 CDD:238113 75/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.