DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG31220

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:275 Identity:93/275 - (33%)
Similarity:127/275 - (46%) Gaps:39/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNINTRHRIVGGQETEVHEYPWMIMLMWFGNF----------YCGASLVNDQYALTAAHCVNGF 128
            ||...|.:|::||.|..::||||:.||::....          .||.||:|.:|.|||||||...
  Fly    95 CGKPQTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHCVTDT 159

  Fly   129 YHRLITVRLLEHNRQDSH--------VKIV------DRRVSRVLIHPKYSTRN--FDSDIALIRF 177
            ..::..|||.||.  .||        .:||      |..|..:..|..|...|  |.:||||:|.
  Fly   160 VLQIQRVRLGEHT--TSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDIALVRL 222

  Fly   178 NEPVRLGIDMHPVCMPTPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGE 242
            .||||..:..:|:|:.....:.......|.|||........|..|:...|.:...||| :..|..
  Fly   223 KEPVRYTMAYYPICVLDYPRSLMKFKMYVAGWGKTGMFDTGSKVLKHAAVKVRKPEEC-SEKYAH 286

  Fly   243 SKITDN-MICAGYVEQGGKDSCQGDSGGPMHVLG-SGDAYQ----LAGIVSWGEGCAKPNAPGVY 301
            ...... .||||.::..|  :|.||||.|:  :| ||.:|:    ||||.|:|..|.....|.|:
  Fly   287 RHFGPRFQICAGGLDNRG--TCDGDSGSPL--MGTSGRSYETITFLAGITSYGGPCGTIGWPSVF 347

  Fly   302 TRVGSFNDWIAENTR 316
            ||...|..||..:.|
  Fly   348 TRTAKFYKWIRAHLR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 87/260 (33%)
Tryp_SPc 83..314 CDD:238113 88/262 (34%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 87/260 (33%)
Tryp_SPc 104..360 CDD:238113 88/262 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.