DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and HPN

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001362370.1 Gene:HPN / 3249 HGNCID:5155 Length:417 Species:Homo sapiens


Alignment Length:282 Identity:95/282 - (33%)
Similarity:137/282 - (48%) Gaps:41/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 CAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLI 133
            |.:|....:.. .|||||::|.:..:||.:.|.:.|...||.||::..:.||||||         
Human   150 CQDCGRRKLPV-DRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHC--------- 204

  Fly   134 TVRLLEHNRQDSHVKI------------VDRRVSRVLIHPKY------STRNFDSDIALIRFNEP 180
               ..|.||..|..::            :...|..|:.|..|      ::....:||||:..:.|
Human   205 ---FPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSP 266

  Fly   181 VRLGIDMHPVCMPTPSENYA-GQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESK 244
            :.|...:.|||:|...:... |:...|||||.....|..:..|||..|||:|.:.|..:::..::
Human   267 LPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQ 331

  Fly   245 ITDNMICAGYVEQGGKDSCQGDSGGPM---HVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGS 306
            |...|.||||.| ||.|:||||||||.   ..:.....::|.||||||.|||....|||||:|..
Human   332 IKPKMFCAGYPE-GGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSD 395

  Fly   307 FNDWIAENTRDACSCAQPEAAG 328
            |.:||.:..:     ...||:|
Human   396 FREWIFQAIK-----THSEASG 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 88/250 (35%)
Tryp_SPc 83..314 CDD:238113 89/252 (35%)
HPNNP_001362370.1 Hepsin-SRCR 51..159 CDD:401275 2/8 (25%)
Tryp_SPc 163..400 CDD:238113 87/249 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4057
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8579
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.