DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and HP

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_005134.1 Gene:HP / 3240 HGNCID:5141 Length:406 Species:Homo sapiens


Alignment Length:325 Identity:95/325 - (29%)
Similarity:147/325 - (45%) Gaps:69/325 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRECAECSCGN----INTRHRIV 84
            ||:..|....|||..|        ||...:|.::|         || |..||.    .|...||:
Human   117 LRTEGDGVYTLNNEKQ--------WINKAVGDKLP---------EC-EAVCGKPKNPANPVQRIL 163

  Fly    85 GGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAA------HCVNGFYHRLI-TVRLLEHNR 142
            ||.......:||...::...|...||:|:|:|:.||.|      |..|.....:. |:.|....:
Human   164 GGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKK 228

  Fly   143 QDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYA--GQTAV 205
            |     :|:  :.:|::||.||    ..||.||:..:.|.:...:.|:|:  ||::||  |:...
Human   229 Q-----LVE--IEKVVLHPNYS----QVDIGLIKLKQKVSVNERVMPICL--PSKDYAEVGRVGY 280

  Fly   206 VTGWGALSEGGPISDTLQEVEVPILSQEEC----RNSNYGESK-----------ITDNMICAGYV 255
            |:|||. :.....:|.|:.|.:|:..|::|    ..|...|.|           :.::..||| :
Human   281 VSGWGR-NANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAG-M 343

  Fly   256 EQGGKDSCQGDSGG--PMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDW----IAEN 314
            .:..:|:|.||:|.  .:|.| ..|.:...||:|:.:.||.... |||.:|.|..||    ||||
Human   344 SKYQEDTCYGDAGSAFAVHDL-EEDTWYATGILSFDKSCAVAEY-GVYVKVTSIQDWVQKTIAEN 406

  Fly   315  314
            Human   407  406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 74/258 (29%)
Tryp_SPc 83..314 CDD:238113 75/260 (29%)
HPNP_005134.1 CCP 33..87 CDD:153056
CCP 92..146 CDD:153056 13/46 (28%)
Tryp_SPc 161..399 CDD:214473 73/254 (29%)
Tryp_SPc 162..402 CDD:238113 73/256 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.