DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and plg

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_958880.2 Gene:plg / 322691 ZFINID:ZDB-GENE-030131-1411 Length:818 Species:Danio rerio


Alignment Length:289 Identity:93/289 - (32%)
Similarity:148/289 - (51%) Gaps:45/289 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 EVPAEW---SSPAKR-------ECAECSCGNINTR-----HRIVGGQETEVHEYPWMIMLMWFGN 105
            :|...|   :.|:|:       :|....||...|:     .|||||..::.|.:||.|.|...|.
Zfish   547 DVNGPWCYTTDPSKKWDYCQIPDCESLKCGQPATKPKRCFGRIVGGCVSKPHSWPWQISLRTRGK 611

  Fly   106 F-YCGASLVNDQYALTAAHCVN-----GFYHRLI---TVRLLEHNRQDSHVKIVDRRVSRVLIHP 161
            . :||.:|::.|:.:|||||:.     ..|..::   |.|..|.::|       :|.|::::..|
Zfish   612 IHFCGGTLIDPQWVVTAAHCLERSDSPSAYKIMLGIHTERATESSKQ-------ERDVTKIIKGP 669

  Fly   162 KYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY---AGQTAVVTGWGALSEGGPISDTLQ 223
            .      .:||||::.:.|..:...:.|||:  |.::|   :.....|||||...:.|. ...|:
Zfish   670 A------GTDIALLKLDRPALINDKVSPVCL--PEKDYIVPSNTECYVTGWGETQDTGG-EGYLK 725

  Fly   224 EVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSW 288
            |...|::..:.|...::...::.|:.:|||.:| ||.||||||||||: |..:.:.:.|.|:.||
Zfish   726 ETGFPVIENKVCNRPSFLNGRVKDHEMCAGNIE-GGNDSCQGDSGGPL-VCYAQNTFVLQGVTSW 788

  Fly   289 GEGCAKPNAPGVYTRVGSFNDWIAENTRD 317
            |.|||....|||||||..|.|||..:.::
Zfish   789 GLGCANAMKPGVYTRVSKFVDWIERSIKE 817

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 83/240 (35%)
Tryp_SPc 83..314 CDD:238113 84/242 (35%)
plgNP_958880.2 PAN_AP_HGF 31..104 CDD:238532
KR 109..190 CDD:214527
KR 190..270 CDD:214527
KR 281..361 CDD:214527
Kringle 376..453 CDD:306546
KR 490..572 CDD:214527 5/24 (21%)
Tryp_SPc 589..813 CDD:238113 84/241 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.