DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and ctrb.1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_997783.1 Gene:ctrb.1 / 322451 ZFINID:ZDB-GENE-030131-1171 Length:263 Species:Danio rerio


Alignment Length:283 Identity:95/283 - (33%)
Similarity:137/283 - (48%) Gaps:43/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SFLDWIQSILG----------PEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMI 98
            :|| ||.|.|.          |.:|...:..|                |||.|:|...|.:||.:
Zfish     2 AFL-WILSCLAFFGAAYGCGIPAIPPVVTGYA----------------RIVNGEEARPHSWPWQV 49

  Fly    99 MLMWFGNF-YCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPK 162
            .|.....| :||.||:|:.:.:|||||.....||:|   |.||:|..:...|....|.:.:.||.
Zfish    50 SLQDSTGFHFCGGSLINENWVVTAAHCNVRTSHRVI---LGEHDRSSNAEAIQTIAVGKSIKHPN 111

  Fly   163 YSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY-AGQTAVVTGWGALSEGGPISDT---LQ 223
            |::...::||.||:...|.::...:.|||:...::|: .|...|.:|||......|  ||   ||
Zfish   112 YNSFTINNDILLIKLATPAKINTHVSPVCLAETNDNFPGGMKCVTSGWGLTRYNAP--DTPALLQ 174

  Fly   224 EVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSW 288
            :..:|:|:.::|:  .|..:.|||.|||||   ..|..||.||||||: |..:...:.|.|||||
Zfish   175 QAALPLLTNDDCK--RYWGTNITDLMICAG---ASGVSSCMGDSGGPL-VCENNRVWTLVGIVSW 233

  Fly   289 GEGCAKPNAPGVYTRVGSFNDWI 311
            |......:.|.||.||.....|:
Zfish   234 GSSTCSTSTPAVYARVTKLRAWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 85/233 (36%)
Tryp_SPc 83..314 CDD:238113 85/234 (36%)
ctrb.1NP_997783.1 Tryp_SPc 33..256 CDD:214473 85/233 (36%)
Tryp_SPc 34..259 CDD:238113 85/234 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.