DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Tmprss11b

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_795998.2 Gene:Tmprss11b / 319875 MGIID:2442893 Length:416 Species:Mus musculus


Alignment Length:300 Identity:102/300 - (34%)
Similarity:139/300 - (46%) Gaps:55/300 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETE 90
            |..|.|||:||....|             |.:.|                   |..||.||....
Mouse   160 SKVDAEKIINNRCGRR-------------PRMSA-------------------TYDRITGGSTAH 192

  Fly    91 VHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNG---------FYHRLITVRLLEHNRQDSH 146
            ..|:||...|...|..||||||:.:::.||||||..|         .:...:|...::|:     
Mouse   193 KGEWPWQASLRVNGKHYCGASLIGERFLLTAAHCFQGTNNPKNLTVSFGTRVTPAYMQHS----- 252

  Fly   147 VKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY-AGQTAVVTGWG 210
                   |..::||..|.......|:|:|:..|.|....|:|.||:|..::.: .|:..||||||
Mouse   253 -------VQEIIIHEDYVKGEHHDDVAVIKLTEKVSFNNDVHRVCLPESTQIFPPGEGVVVTGWG 310

  Fly   211 ALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLG 275
            :.|..|.....||:..:.|:....|.:......:|.|.|:||||:| |..|:||||||||:....
Mouse   311 SFSYNGKSPLLLQKASIKIIDTNTCNSEEAYGGRIVDTMLCAGYLE-GSIDACQGDSGGPLVHPN 374

  Fly   276 SGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENT 315
            |.|.:.|.||||||..|.:.|.||||.||.|:.:|||..|
Mouse   375 SRDIWYLVGIVSWGHECGRVNKPGVYMRVTSYRNWIASKT 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 87/238 (37%)
Tryp_SPc 83..314 CDD:238113 89/240 (37%)
Tmprss11bNP_795998.2 SEA 46..140 CDD:279699
Tryp_SPc 184..410 CDD:214473 87/238 (37%)
Tryp_SPc 185..413 CDD:238113 89/240 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3995
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.